Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5409 |
| Peptide Name | CONG7_ARAHY |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arachis hypogaea |
| Plant Source (Common Name) | Peanut |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Allergen; Direct protein sequencing; IgE-binding protein; Polymorphism; Protease inhibitor; Seed storage protein; Serine protease inhibitor; Signal; Storage protein | Conglutin-7 precursor (Seed storage protein SSP1) (Seed storage,protein SSP2) (2S protein 1) (Allergen Ara h 2) (Allergen Ara h 2.02),[Contains: Conglutin-7 small chain (Allergen Ara h 2 light chain);,Conglutin-7 large chain (Allergen Ara h 2 heavy chain)]. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | ERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQMAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQCGLRAPQRCDLEVESGGRDRYQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQ |
| Sequence Length | 172 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 20114.26 |
| Monoisotopic Molecular Weight (Da) | 20101.56 |
| Isoelectric Point (pI) | 5.99 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q6PSU2 |
| NCBI | --NA-- |
| EMBL | AY158467 |
| Link to Source Databases | SPdb45290 |
|---|
| Addtional Information | FUNCTION:Weak inhibitor of trypsin.BIOPHYSICOCHEMICAL PROPERTIES:Temperature dependence: Thermostable;SUBUNIT:The mature protein consists of a small and a large chain linked by disulfide bonds.TISSUE SPECIFICITY:Expressed in seeds, not expressed in leaves, roots and pegs.DEVELOPMENTAL STAGE:Expressed at very low levels in immature seeds and at high levels from 40-75 days after pollination.Expression decreases after 75 days after pollination.INDUCTION:Repressed by water stress.MASS SPECTROMETRY:Mass=18050; Method=MALDI; Range=22-172; Note=Prior to proteolytic processing into mature heterodimer; Source=PubMed:12759484;MASS SPECTROMETRY:Mass=16670; Method=MALDI; Range=22-75, 88-172; Note=In short form, prior to proteolytic processing into mature heterodimer; Source=PubMed:12759484;ALLERGEN:Causes an allergic reaction in human. Binds to IgE.MISCELLANEOUS:Resistant to proteolysis.SIMILARITY:Belongs to the 2S seed storage albumins family. |
