PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5409	CONG7_ARAHY	--NA--	"Arachis hypogaea"	Fabaceae	--NA--	Signaling-peptide	"Allergen; Direct protein sequencing; IgE-binding protein; Polymorphism; Protease inhibitor; Seed storage protein; Serine protease inhibitor; Signal; Storage protein | Conglutin-7 precursor (Seed storage protein SSP1) (Seed storage,protein SSP2) (2S protein 1) (Allergen Ara h 2) (Allergen Ara h 2.02),[Contains: Conglutin-7 small chain (Allergen Ara h 2 light chain);,Conglutin-7 large chain (Allergen Ara h 2 heavy chain)]."	--NA--	ERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQMAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQCGLRAPQRCDLEVESGGRDRYQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQ	172	"Experimental evidence at protein level"	20114.26	20101.56	5.99	--NA--	"FUNCTION:Weak inhibitor of trypsin.BIOPHYSICOCHEMICAL PROPERTIES:Temperature dependence: Thermostable;SUBUNIT:The mature protein consists of a small and a large chain linked by disulfide bonds.TISSUE SPECIFICITY:Expressed in seeds, not expressed in leaves, roots and pegs.DEVELOPMENTAL STAGE:Expressed at very low levels in immature seeds and at high levels from 40-75 days after pollination.Expression decreases after 75 days after pollination.INDUCTION:Repressed by water stress.MASS SPECTROMETRY:Mass=18050; Method=MALDI; Range=22-172; Note=Prior to proteolytic processing into mature heterodimer; Source=PubMed:12759484;MASS SPECTROMETRY:Mass=16670; Method=MALDI; Range=22-75, 88-172; Note=In short form, prior to proteolytic processing into mature heterodimer; Source=PubMed:12759484;ALLERGEN:Causes an allergic reaction in human. Binds to IgE.MISCELLANEOUS:Resistant to proteolysis.SIMILARITY:Belongs to the 2S seed storage albumins family."