Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5007 |
| Peptide Name | PEL18_SOLLC |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Solanum lycopersicum, Lycopersicon esculentum |
| Plant Source (Common Name) | Tomato |
| Plant Family | Solanaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Calcium; Glycoprotein; Lyase; Metal-binding; Secreted; Signal | Probable pectate lyase P18 precursor (EC 4.2.2.2) (Style development-,specific protein 9612).Secreted. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | DDPVNPKPGTLRHAVIQDEPLWIIFKRDMVIQLKQELVMNSYKTIDGRGADLMLNGAYFRQTGAGASSSSTYARASSLSARPSSLVGSITTNAGPVNCKKGDGISIFGGKNIWVDHCSLSNCHDGLIDAIHGSTAITISNNYFTHHDKVMGSGNPIDRLLAMQPQLGKKSPAFSYCAIGFGKNAIGGKNGRIYVVTDSGNGSRCLLGHSDSFTQDKGMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMSTLFFTFSLLLLAPLLVISSIQDPELVVQDVHRSINASLTRRNLGYLSCMYAIGGSAAPTINSQGNRFLAPNEKYRKEVTKHEDAPESQWRSWNWRSEGSVHISGGPCITIHHTSNIIIHGINIHDCKQSGNGNIRDSPNHSGWWDVSD |
| Sequence Length | 404 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 44297.91 |
| Monoisotopic Molecular Weight (Da) | 44269.9 |
| Isoelectric Point (pI) | 8.52 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P24396 |
| NCBI | --NA-- |
| EMBL | X55193 |
| Link to Source Databases | SPdb187123 |
|---|
| Addtional Information | FUNCTION:May have a role in the development of the transmitting tissue of the style and/or in the events related to pollination such as some aspect in the facilitation of compatible pollen tube growth.CATALYTIC ACTIVITY:Eliminative cleavage of (1->4)-alpha-D- galacturonan to give oligosaccharides with 4-deoxy-alpha-D-galact- 4-enuronosyl groups at their non-reducing ends.COFACTOR:Binds 1 calcium ion. Required for its activity (By similarity).TISSUE SPECIFICITY:Predominantly found in the pistil where it is found in the outer five layers of the strands of transmitting tissue within the upper two-thirds of the style. Found at much lower levels in the anthers and vegetative organs.DEVELOPMENTAL STAGE:Maximum levels are found during anthesis.SIMILARITY:Belongs to the polysaccharide lyase 1 family. |
