PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5007	PEL18_SOLLC	--NA--	"Solanum lycopersicum, Lycopersicon esculentum"	Solanaceae	--NA--	Signaling-peptide	"Calcium; Glycoprotein; Lyase; Metal-binding; Secreted; Signal | Probable pectate lyase P18 precursor (EC 4.2.2.2) (Style development-,specific protein 9612).Secreted."	--NA--	DDPVNPKPGTLRHAVIQDEPLWIIFKRDMVIQLKQELVMNSYKTIDGRGADLMLNGAYFRQTGAGASSSSTYARASSLSARPSSLVGSITTNAGPVNCKKGDGISIFGGKNIWVDHCSLSNCHDGLIDAIHGSTAITISNNYFTHHDKVMGSGNPIDRLLAMQPQLGKKSPAFSYCAIGFGKNAIGGKNGRIYVVTDSGNGSRCLLGHSDSFTQDKGMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMSTLFFTFSLLLLAPLLVISSIQDPELVVQDVHRSINASLTRRNLGYLSCMYAIGGSAAPTINSQGNRFLAPNEKYRKEVTKHEDAPESQWRSWNWRSEGSVHISGGPCITIHHTSNIIIHGINIHDCKQSGNGNIRDSPNHSGWWDVSD	404	"Experimental evidence at transcript level"	44297.91	44269.9	8.52	--NA--	"FUNCTION:May have a role in the development of the transmitting tissue of the style and/or in the events related to pollination such as some aspect in the facilitation of compatible pollen tube growth.CATALYTIC ACTIVITY:Eliminative cleavage of (1->4)-alpha-D- galacturonan to give oligosaccharides with 4-deoxy-alpha-D-galact- 4-enuronosyl groups at their non-reducing ends.COFACTOR:Binds 1 calcium ion. Required for its activity (By similarity).TISSUE SPECIFICITY:Predominantly found in the pistil where it is found in the outer five layers of the strands of transmitting tissue within the upper two-thirds of the style. Found at much lower levels in the anthers and vegetative organs.DEVELOPMENTAL STAGE:Maximum levels are found during anthesis.SIMILARITY:Belongs to the polysaccharide lyase 1 family."