Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4768 |
| Peptide Name | PEL_ZINEL |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Zinnia elegans |
| Plant Source (Common Name) | Zinnia |
| Plant Family | Asteraceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Calcium; Glycoprotein; Lyase; Metal-binding; Signal | Pectate lyase precursor (EC 4.2.2.2) (ZePel). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | CDGISIFASKDIWIDHNSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLDPVNPVPGTLRYAVIQDEPLWIIFKRDMVIQLRQELVMNSHKTIDGRGVNLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMLMLNGAYFRESGGRAASSFARASSLSGRPSTLVASMTRSAGALVCRKGSRMATTILPLILFISSLAIASSSPSRTPHAIVNEVHKSINASRRNLGYLSCGTGNPIDDCWRCDPNWANNRQRLADCAIGFGKNAMGGRNGRIYVVTDPGNDVHIGNGPCITIHYASNIIIHGIHIHDCKQAGNGNIRNSPHHSGWWTQSDGYAIGGSASPTIYSQGNRFLAPNTRFDKEVTKHENAPESEWKNWNWRSEGD |
| Sequence Length | 401 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 44406.9 |
| Monoisotopic Molecular Weight (Da) | 44378.7 |
| Isoelectric Point (pI) | 8.51 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | O24554 |
| NCBI | --NA-- |
| EMBL | Y09541 |
| Link to Source Databases | SPdb187195 |
|---|
| Addtional Information | FUNCTION:Involved in the degradation of pectin. May assist in the removal and modification of an existing pectin matrix in order to allow the deposition of newly synthesized walls polymers for a specialized function or to create an architecture that is extensible.CATALYTIC ACTIVITY:Eliminative cleavage of (1->4)-alpha-D- galacturonan to give oligosaccharides with 4-deoxy-alpha-D-galact- 4-enuronosyl groups at their non-reducing ends.COFACTOR:Binds 1 calcium ion. Required for its activity.BIOPHYSICOCHEMICAL PROPERTIES:Kinetic parameters: Vmax=0.12 umol/min/mg enzyme; pH dependence: Optimum pH is 10;TISSUE SPECIFICITY:Expressed in sites of vascular differentiation and in new primordia on the flank of the shoot meristem.INDUCTION:Up-regulated by auxin.SIMILARITY:Belongs to the polysaccharide lyase 1 family. |
