PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4768	PEL_ZINEL	--NA--	"Zinnia elegans"	Asteraceae	--NA--	Signaling-peptide	"Calcium; Glycoprotein; Lyase; Metal-binding; Signal | Pectate lyase precursor (EC 4.2.2.2) (ZePel)."	--NA--	CDGISIFASKDIWIDHNSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLDPVNPVPGTLRYAVIQDEPLWIIFKRDMVIQLRQELVMNSHKTIDGRGVNLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMLMLNGAYFRESGGRAASSFARASSLSGRPSTLVASMTRSAGALVCRKGSRMATTILPLILFISSLAIASSSPSRTPHAIVNEVHKSINASRRNLGYLSCGTGNPIDDCWRCDPNWANNRQRLADCAIGFGKNAMGGRNGRIYVVTDPGNDVHIGNGPCITIHYASNIIIHGIHIHDCKQAGNGNIRNSPHHSGWWTQSDGYAIGGSASPTIYSQGNRFLAPNTRFDKEVTKHENAPESEWKNWNWRSEGD	401	"Experimental evidence at protein level"	44406.9	44378.7	8.51	--NA--	"FUNCTION:Involved in the degradation of pectin. May assist in the removal and modification of an existing pectin matrix in order to allow the deposition of newly synthesized walls polymers for a specialized function or to create an architecture that is extensible.CATALYTIC ACTIVITY:Eliminative cleavage of (1->4)-alpha-D- galacturonan to give oligosaccharides with 4-deoxy-alpha-D-galact- 4-enuronosyl groups at their non-reducing ends.COFACTOR:Binds 1 calcium ion. Required for its activity.BIOPHYSICOCHEMICAL PROPERTIES:Kinetic parameters: Vmax=0.12 umol/min/mg enzyme; pH dependence: Optimum pH is 10;TISSUE SPECIFICITY:Expressed in sites of vascular differentiation and in new primordia on the flank of the shoot meristem.INDUCTION:Up-regulated by auxin.SIMILARITY:Belongs to the polysaccharide lyase 1 family."