Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4762 |
| Peptide Name | 2SS_RICCO |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Ricinus communis |
| Plant Source (Common Name) | Castor bean |
| Plant Family | Euphorbiaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Allergen; Cleavage on pair of basic residues; Direct protein sequencing; Phosphoprotein; Polymorphism; Pyrrolidone carboxylic acid; Seed storage protein; Signal; Storage protein | 2S albumin precursor (Allergen Ric c 1/3) [Contains: Allergen Ric c 3,small chain (4.7 kDa napin-like protein small chain) (RS1A) (CB-1A,small chain); Allergen Ric c 3 large chain (RL1) (CB-1A large chain);,Allergen Ric c 1 small chain (2S albumin small chain) (4 kDa napin-,like protein small chain) (RS2B); Allergen Ric c 1 large chain (2S,albumin large chain) (7.3 kDa napin-like protein large chain) (RL2)]. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | CCDHLKQMQSQCRCEGLRQAIEQQQSQGQLQGQDVFEAFRTAANLPSMCGMAKLIPTIALVSVLLFIIANASFAYRTTITTIEIDESKGEREGSSSQQCRQEVQRKDLSSCERYLRQSSSRRSPGEEVLRMPGDENQQQESQQLQQCCNQRQTRTNPSQQGCRGQIQEQQNLRQCQEYIKQQVSGQGPRRSDNQERSLRGVKQVRDECQCEAIKYIAEDQIQQGQLHGEESERVAQRAGEIVSSCGVRCMVSPTECRF |
| Sequence Length | 258 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 29289.69 |
| Monoisotopic Molecular Weight (Da) | 29271.05 |
| Isoelectric Point (pI) | 6.88 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P01089 |
| NCBI | --NA-- |
| EMBL | X54158 |
| Link to Source Databases | SPdb491 |
|---|
| Addtional Information | FUNCTION:2S seed storage proteins.SUBUNIT:The 2 mature proteins consist of heterodimers of a small and a large chain; disulfide-linked.DEVELOPMENTAL STAGE:Expressed in ripening seeds during testa formation and desiccation.PTM:The N-terminus of both large chains is blocked.PTM:The C-terminus of the allergen Ric c 1 and allergen Ric c 3 small chains are heterogeneous and the length of the chains can vary from 33 to 36 amino acids and from 36 to 40 amino acids respectively.ALLERGEN:Causes an allergic reaction in human.BIOTECHNOLOGY:Ric C 3 constitutes the peptidic component of the immunomodulator Inmunoferon.MISCELLANEOUS:The allergen Ric c 1 small chain acts as a calmodulin (CaM) antagonist that inhibits CaM-dependent myosin light chain kinase with IC(50)= 0.25 uM.SIMILARITY:Belongs to the 2S seed storage albumins family. |
