PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4762	2SS_RICCO	--NA--	"Ricinus communis"	Euphorbiaceae	--NA--	Signaling-peptide	"3D-structure; Allergen; Cleavage on pair of basic residues; Direct protein sequencing; Phosphoprotein; Polymorphism; Pyrrolidone carboxylic acid; Seed storage protein; Signal; Storage protein | 2S albumin precursor (Allergen Ric c 1/3) [Contains: Allergen Ric c 3,small chain (4.7 kDa napin-like protein small chain) (RS1A) (CB-1A,small chain); Allergen Ric c 3 large chain (RL1) (CB-1A large chain);,Allergen Ric c 1 small chain (2S albumin small chain) (4 kDa napin-,like protein small chain) (RS2B); Allergen Ric c 1 large chain (2S,albumin large chain) (7.3 kDa napin-like protein large chain) (RL2)]."	--NA--	CCDHLKQMQSQCRCEGLRQAIEQQQSQGQLQGQDVFEAFRTAANLPSMCGMAKLIPTIALVSVLLFIIANASFAYRTTITTIEIDESKGEREGSSSQQCRQEVQRKDLSSCERYLRQSSSRRSPGEEVLRMPGDENQQQESQQLQQCCNQRQTRTNPSQQGCRGQIQEQQNLRQCQEYIKQQVSGQGPRRSDNQERSLRGVKQVRDECQCEAIKYIAEDQIQQGQLHGEESERVAQRAGEIVSSCGVRCMVSPTECRF	258	"Experimental evidence at protein level"	29289.69	29271.05	6.88	--NA--	"FUNCTION:2S seed storage proteins.SUBUNIT:The 2 mature proteins consist of heterodimers of a small and a large chain; disulfide-linked.DEVELOPMENTAL STAGE:Expressed in ripening seeds during testa formation and desiccation.PTM:The N-terminus of both large chains is blocked.PTM:The C-terminus of the allergen Ric c 1 and allergen Ric c 3 small chains are heterogeneous and the length of the chains can vary from 33 to 36 amino acids and from 36 to 40 amino acids respectively.ALLERGEN:Causes an allergic reaction in human.BIOTECHNOLOGY:Ric C 3 constitutes the peptidic component of the immunomodulator Inmunoferon.MISCELLANEOUS:The allergen Ric c 1 small chain acts as a calmodulin (CaM) antagonist that inhibits CaM-dependent myosin light chain kinase with IC(50)= 0.25 uM.SIMILARITY:Belongs to the 2S seed storage albumins family."