Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4339 |
| Peptide Name | PIP21_PEA |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Pisum sativum |
| Plant Source (Common Name) | Garden pea |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Direct protein sequencing; Glycoprotein; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Kunitz-type trypsin inhibitor-like 1 protein precursor (Protease,inhibitor from pea 1).Secreted (Probable). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AIRGPAGGGVRLGRTGDLTCPVTVLQDRQEVKNGLPVKFVIPEISPGIIFLFKIEKHESGFGYKLGFCVKGSPTCLDVGRFDNDEDGRRLNLTEHESFQVMKPLSPLTLSFFLFVFITNLSLAFSNEDVEQVLDFNGNPIFPGVQYFILPTGTPIEIEYTKKPNCAKSSKWLVFVDNVIQKACVGIGGPENYPGVQTLSGVFIQAEANDAEFIKSVV |
| Sequence Length | 217 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 23792.37 |
| Monoisotopic Molecular Weight (Da) | 23777.29 |
| Isoelectric Point (pI) | 5.29 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q41015 |
| NCBI | --NA-- |
| EMBL | X82595 |
| Link to Source Databases | SPdb191724 |
|---|
| Addtional Information | FUNCTION:Might act as a protease inhibitor involved in plant defense responses.TISSUE SPECIFICITY:Expressed in roots, leaves, epidermal layers of elongating stems, meristems and in the vascular system.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family.CAUTION:Was originally (PubMed:7559605) thought to be an alpha-L- fucosidase.CAUTION:The nucleotide sequence (X82595) deposited at the EMBL differs from that shown in Ref.1 with the same accession number. |
