PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4339	PIP21_PEA	--NA--	"Pisum sativum"	Fabaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Glycoprotein; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Kunitz-type trypsin inhibitor-like 1 protein precursor (Protease,inhibitor from pea 1).Secreted (Probable)."	--NA--	AIRGPAGGGVRLGRTGDLTCPVTVLQDRQEVKNGLPVKFVIPEISPGIIFLFKIEKHESGFGYKLGFCVKGSPTCLDVGRFDNDEDGRRLNLTEHESFQVMKPLSPLTLSFFLFVFITNLSLAFSNEDVEQVLDFNGNPIFPGVQYFILPTGTPIEIEYTKKPNCAKSSKWLVFVDNVIQKACVGIGGPENYPGVQTLSGVFIQAEANDAEFIKSVV	217	"Experimental evidence at protein level"	23792.37	23777.29	5.29	--NA--	"FUNCTION:Might act as a protease inhibitor involved in plant defense responses.TISSUE SPECIFICITY:Expressed in roots, leaves, epidermal layers of elongating stems, meristems and in the vascular system.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family.CAUTION:Was originally (PubMed:7559605) thought to be an alpha-L- fucosidase.CAUTION:The nucleotide sequence (X82595) deposited at the EMBL differs from that shown in Ref.1 with the same accession number."