Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4273 |
| Peptide Name | AGAL_ORYSJ |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Oryza sativa subsp. Japonica |
| Plant Source (Common Name) | Rice |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Direct protein sequencing; Glycoprotein; Glycosidase; Hydrolase; Signal | Alpha-galactosidase precursor (EC 3.2.1.22) (Melibiase) (Alpha-D-,galactoside galactohydrolase). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AGSQTCSNKMPGSLDHEEQDVKTFASWGVDYLKYDNCNDAGRSVMERYTRARRRAFENGLGRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSMARASSSSSPPSPRLLLLLLVAVAATLLPEAAALGNFTAESRGARWRSRRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGDIADNWGSMTSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQIQYVNIDDCWAEYSRDSQGNFVPNRQTFPSGIKALADYVHAKGLKLGIYSDRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLLSASVAPHDCKMYVLTPN |
| Sequence Length | 417 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 45821.24 |
| Monoisotopic Molecular Weight (Da) | 45792.28 |
| Isoelectric Point (pI) | 8.14 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q9FXT4 |
| NCBI | --NA-- |
| EMBL | AB039671 |
| Link to Source Databases | SPdb6384 |
|---|
| Addtional Information | FUNCTION:Hydrolyzes melibiose, raffinose and stachyose in the following decreasing order of reactivity: raffinose, melibiose, stachyose.CATALYTIC ACTIVITY:Hydrolysis of terminal, non-reducing alpha-D- galactose residues in alpha-D-galactosides, including galactose oligosaccharides, galactomannans and galactohydrolase.ENZYME REGULATION:1mM Hg(2) and Ag(2) decrease activity by 98% and 96% respectively. 1mM Para-chloromercuribenzoic acid (PCMB) completely inhibits enzymatic activity.BIOPHYSICOCHEMICAL PROPERTIES:pH dependence: Optimum pH is 5.0. Slowly inactivated above pH 8.0 and below pH 3; Temperature dependence: Optimum temperature is 45 degrees Celsius with p-nitrophenyl- alpha-D-galactopyranoside as substrate;SIMILARITY:Belongs to the glycosyl hydrolase 27 family.SEQUENCE CAUTION:Sequence=BAF26853.1; Type=Erroneous gene model prediction; |
