Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2547 |
| Peptide Name | Trypsin inhibitor 2 |
| PMID(s) | 19765785 |
| Plant Source (Scientific Name) | Opuntia streptacantha, Opuntia cardona |
| Plant Source (Common Name) | prickly pear cactus |
| Plant Family | Cactaceae |
| Peptide Family | --NA-- |
| Peptide Function | Enzyme-inhibitor |
| Peptide Function Description | inhibits trypsin-like proteases from the guts of the insect pests P.truncatus, P.americana, Acheta sp and Gryllus sp. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | JQCAERGQSCNPYEGIECCGDILCIQPRIWPPVPGRCA |
| Sequence Length | 38 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 4176.85 |
| Monoisotopic Molecular Weight (Da) | 4173.91 |
| Isoelectric Point (pI) | 4.41 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P86388 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | EROP-Moscow_09074 |
|---|
| Addtional Information | NA |
