PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2547	"Trypsin inhibitor 2"	19765785	"Opuntia streptacantha, Opuntia cardona"	Cactaceae	--NA--	Enzyme-inhibitor	"inhibits trypsin-like proteases from the guts of the insect pests P.truncatus, P.americana, Acheta sp and Gryllus sp."	--NA--	JQCAERGQSCNPYEGIECCGDILCIQPRIWPPVPGRCA	38	"Experimental evidence at protein level"	4176.85	4173.91	4.41	--NA--	NA