Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_6155 |
| Peptide Name | ICIW_WHEAT |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Triticum aestivum |
| Plant Source (Common Name) | Wheat |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Direct protein sequencing; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Subtilisin-chymotrypsin inhibitor WSCI precursor.Secreted (Probable). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | MSSVVKKPLGGNTDTGDHHNQKTEWPELVGKSVEEAKKVILQDKSEAQIVVLPVGTIVTMEYRIDRVRLFVDSLDKIAQVPRVG |
| Sequence Length | 84 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 9325.75 |
| Monoisotopic Molecular Weight (Da) | 9319.99 |
| Isoelectric Point (pI) | 6.72 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P82977 |
| NCBI | --NA-- |
| EMBL | DQ025758 |
| Link to Source Databases | SPdb120251 |
|---|
| Addtional Information | FUNCTION:Inhibits B.lichenoformis subtilisin, B.subtilis subtilisin, bovine pancreatic alpha-chymotrypsin and porcine alpha-chymotrypsin with Ki of 3.92 nM, 5.70 nM, 7.24 nM and 9.35 nM respectively. B.lichenoformis subtilisin is inhibited with a molar ratio of 1:0.87. Also inhibits chymotrypsin-like activities from the digestive tracts of the insect larvae T.molitor, P.interpunctella and H.armigera. Does not inhibit bovine pancreatic trypsin, porcine pancreatic elastase, or human leukocyte elastase.BIOPHYSICOCHEMICAL PROPERTIES:Temperature dependence: Optimum temperature is 25 degrees Celsius when incubation is carried out at pH 7.0-9.0;SUBUNIT:Monomer.MASS SPECTROMETRY:Mass=8126.3; Mass_error=0.5; Method=Electrospray; Range=13-84; Source=PubMed:12675523;SIMILARITY:Belongs to the protease inhibitor I13 (potato type I serine protease inhibitor) family. |
