PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6155	ICIW_WHEAT	--NA--	"Triticum aestivum"	Poaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Subtilisin-chymotrypsin inhibitor WSCI precursor.Secreted (Probable)."	--NA--	MSSVVKKPLGGNTDTGDHHNQKTEWPELVGKSVEEAKKVILQDKSEAQIVVLPVGTIVTMEYRIDRVRLFVDSLDKIAQVPRVG	84	"Experimental evidence at protein level"	9325.75	9319.99	6.72	--NA--	"FUNCTION:Inhibits B.lichenoformis subtilisin, B.subtilis subtilisin, bovine pancreatic alpha-chymotrypsin and porcine alpha-chymotrypsin with Ki of 3.92 nM, 5.70 nM, 7.24 nM and 9.35 nM respectively. B.lichenoformis subtilisin is inhibited with a molar ratio of 1:0.87. Also inhibits chymotrypsin-like activities from the digestive tracts of the insect larvae T.molitor, P.interpunctella and H.armigera. Does not inhibit bovine pancreatic trypsin, porcine pancreatic elastase, or human leukocyte elastase.BIOPHYSICOCHEMICAL PROPERTIES:Temperature dependence: Optimum temperature is 25 degrees Celsius when incubation is carried out at pH 7.0-9.0;SUBUNIT:Monomer.MASS SPECTROMETRY:Mass=8126.3; Mass_error=0.5; Method=Electrospray; Range=13-84; Source=PubMed:12675523;SIMILARITY:Belongs to the protease inhibitor I13 (potato type I serine protease inhibitor) family."