Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_6118 |
| Peptide Name | NP24_SOLLC |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Solanum lycopersicum, Lycopersicon esculentum |
| Plant Source (Common Name) | Tomato |
| Plant Family | Solanaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Antimicrobial; Cytoplasm; Direct protein sequencing; Fungicide; Pathogenesis-related protein; Plant defense; Polymorphism; Signal; Stress response | Protein NP24 precursor (Pathogenesis-related protein PR P23) (Salt-,induced protein).Cytoplasm. Note=Or soluble fractions of cytoplasmic organelles, except mitochond |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | MGYLTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGNGECPRALKVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCTANIQTWVINAPRGTKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPSYPQDDPTSTFTCPGGSTNYRVVFCPNGVADPNFPLEMPASTDEVAK |
| Sequence Length | 247 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 26646.21 |
| Monoisotopic Molecular Weight (Da) | 26628.53 |
| Isoelectric Point (pI) | 8.28 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P12670 |
| NCBI | --NA-- |
| EMBL | AF093743 |
| Link to Source Databases | SPdb171483 |
|---|
| Addtional Information | FUNCTION:Has antifungal activity against P.betae and F.dahliae.May be involved in disease resistance in tomatoes and/or have a possible role in fruit development and ripening.TISSUE SPECIFICITY:Highest levels of both isoforms found in the outer pericarp, with smaller amounts in the inner pericarp.DEVELOPMENTAL STAGE:NP24 I is low in green tomatoes and it increased substantially during ripening, with the largest increase occurring between the pink and red stages. NP24 II is relatively high in green tomatoes and it increased somewhat as the fruit turned pink, but not during further ripening.INDUCTION:By salt stress or by viroids.SIMILARITY:Belongs to the thaumatin family. |
