PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6118	NP24_SOLLC	--NA--	"Solanum lycopersicum, Lycopersicon esculentum"	Solanaceae	--NA--	Signaling-peptide	"3D-structure; Antimicrobial; Cytoplasm; Direct protein sequencing; Fungicide; Pathogenesis-related protein; Plant defense; Polymorphism; Signal; Stress response | Protein NP24 precursor (Pathogenesis-related protein PR P23) (Salt-,induced protein).Cytoplasm. Note=Or soluble fractions of cytoplasmic organelles, except mitochond"	--NA--	MGYLTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGNGECPRALKVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCTANIQTWVINAPRGTKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPSYPQDDPTSTFTCPGGSTNYRVVFCPNGVADPNFPLEMPASTDEVAK	247	"Experimental evidence at protein level"	26646.21	26628.53	8.28	--NA--	"FUNCTION:Has antifungal activity against P.betae and F.dahliae.May be involved in disease resistance in tomatoes and/or have a possible role in fruit development and ripening.TISSUE SPECIFICITY:Highest levels of both isoforms found in the outer pericarp, with smaller amounts in the inner pericarp.DEVELOPMENTAL STAGE:NP24 I is low in green tomatoes and it increased substantially during ripening, with the largest increase occurring between the pink and red stages. NP24 II is relatively high in green tomatoes and it increased somewhat as the fruit turned pink, but not during further ripening.INDUCTION:By salt stress or by viroids.SIMILARITY:Belongs to the thaumatin family."