Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_5987 |
| Peptide Name | ATPI_MARPO |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Marchantia polymorpha |
| Plant Source (Common Name) | Liverwort |
| Plant Family | Marchantiaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | CF(0); Chloroplast; Hydrogen ion transport; Ion transport; Membrane; Plastid; Signal; Transmembrane; Transport | Chloroplast ATP synthase a chain precursor (EC 3.6.3.14) (ATPase,subunit IV).Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | LSLAVLATRNLQTIPMGGQNFVEYVLEFIRDLTRTQIGEEEYRPWVPFIGMSHTAKMASTFNNFYEISNVEVGQHFYWQLGSFQVHAQVLITSWIVIAILTMFLFIFVSNWSGALFPWRVFELPNGELAAPTNDINTTVALALLTSVAYFVVAVLISLVPLVVPIPMMFLGLFTSAIQALIFATLAAAYIGESMEGHHYAGLHKKGLSYFGKYIQPTPVLLPINILEDFTKPLSLSFRLFGNILADEL |
| Sequence Length | 248 |
| Validation | Protein inferred from homology |
| Average Molecular Weight (Da) | 27742.47 |
| Monoisotopic Molecular Weight (Da) | 27724.58 |
| Isoelectric Point (pI) | 5.44 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P06289 |
| NCBI | --NA-- |
| EMBL | X04465 |
| Link to Source Databases | SPdb22549 |
| Addtional Information | FUNCTION:Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.CATALYTIC ACTIVITY:ATP H(2)O H()(In) = ADP phosphate H()(Out).SUBUNIT:F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c.SIMILARITY:Belongs to the ATPase A chain family. |