PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5987	ATPI_MARPO	--NA--	"Marchantia polymorpha"	Marchantiaceae	--NA--	Signaling-peptide	"CF(0); Chloroplast; Hydrogen ion transport; Ion transport; Membrane; Plastid; Signal; Transmembrane; Transport | Chloroplast ATP synthase a chain precursor (EC 3.6.3.14) (ATPase,subunit IV).Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein."	--NA--	LSLAVLATRNLQTIPMGGQNFVEYVLEFIRDLTRTQIGEEEYRPWVPFIGMSHTAKMASTFNNFYEISNVEVGQHFYWQLGSFQVHAQVLITSWIVIAILTMFLFIFVSNWSGALFPWRVFELPNGELAAPTNDINTTVALALLTSVAYFVVAVLISLVPLVVPIPMMFLGLFTSAIQALIFATLAAAYIGESMEGHHYAGLHKKGLSYFGKYIQPTPVLLPINILEDFTKPLSLSFRLFGNILADEL	248	"Protein inferred from homology"	27742.47	27724.58	5.44	--NA--	"FUNCTION:Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.CATALYTIC ACTIVITY:ATP H(2)O H()(In) = ADP phosphate H()(Out).SUBUNIT:F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c.SIMILARITY:Belongs to the ATPase A chain family."