Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_5908 |
| Peptide Name | AFP4_RAPSA |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Raphanus sativus |
| Plant Source (Common Name) | Radish |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Antimicrobial; Fungicide; Plant defense; Pyrrolidone carboxylic acid; Secreted; Signal | Cysteine-rich antifungal protein 4 precursor (AFP4).Secreted. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | KNQCINLEGARHGSCNYIFPYHRCICYFPCMAKFVSIITLLFVALVLFAAFEAPTMVEAQKLCERSSGTWSGVCGNNNAC |
| Sequence Length | 80 |
| Validation | Protein inferred from homology |
| Average Molecular Weight (Da) | 8873.39 |
| Monoisotopic Molecular Weight (Da) | 8867.23 |
| Isoelectric Point (pI) | 8.2 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | O24331 |
| NCBI | --NA-- |
| EMBL | X97318 |
| Link to Source Databases | SPdb6327 |
| Addtional Information | FUNCTION:Possesses antifungal activity sensitive to inorganic cations (By similarity).SIMILARITY:Belongs to the plant defensin family. |