PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5908	AFP4_RAPSA	--NA--	"Raphanus sativus"	Brassicaceae	--NA--	Signaling-peptide	"Antimicrobial; Fungicide; Plant defense; Pyrrolidone carboxylic acid; Secreted; Signal | Cysteine-rich antifungal protein 4 precursor (AFP4).Secreted."	--NA--	KNQCINLEGARHGSCNYIFPYHRCICYFPCMAKFVSIITLLFVALVLFAAFEAPTMVEAQKLCERSSGTWSGVCGNNNAC	80	"Protein inferred from homology"	8873.39	8867.23	8.2	--NA--	"FUNCTION:Possesses antifungal activity sensitive to inorganic cations (By similarity).SIMILARITY:Belongs to the plant defensin family."