Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_5901
Peptide Name	CYT10_ORYSI
PMID(s)	--NA--
Plant Source (Scientific Name)	Oryza sativa subsp. Indica
Plant Source (Common Name)	Rice
Plant Family	Poaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	Plant defense; Protease inhibitor; Secreted; Signal; Thiol protease inhibitor | Cysteine proteinase inhibitor 10 precursor (Oryzacystatin-10),(Oryzacystatin X) (OC-X).Secreted (Potential).
Activity Against	--NA--
IC50 value	--NA--
Sequence	KMATSPMLFLVSLLLVLVAAATGDEASPSNAAAPAAPVLVGGRTEIRDVGSNKAVQSLGRFAVAEHNRRLRHGGSGGPADPVPVKLAFARVVEAQKQVVSGVAYYLKVAASARDPRGGAAAGGDRVFDAVVVVKAWLKSKELVSFTPASST
Sequence Length	151
Validation	Experimental evidence at transcript level
Average Molecular Weight (Da)	15447.81
Monoisotopic Molecular Weight (Da)	15438.32
Isoelectric Point (pI)	10.15
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_5901

External links (Uniprot, PDB and Source Information Database)
Uniprot	A2XS65, P0C579
NCBI	--NA--
EMBL	CR855121, AL731588
Link to Source Databases	Spdb56066, Spdb56067
Addtional Information	FUNCTION:Specific inhibitor of cysteine proteinases. Probably involved in the regulation of endogenous processes and in defense against pests and pathogens (By similarity).SIMILARITY:Belongs to the cystatin family. Phytocystatin subfamily.SIMILARITY:Contains 1 cystatin domain.SEQUENCE CAUTION:Sequence=EAY93675.1; Type=Frameshift; Positions=Several; Sequence=EAY93675.1; Type=Miscellaneous discrepancy; Note=Sequencing errors;