PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5901	CYT10_ORYSI	--NA--	"Oryza sativa subsp. Indica"	Poaceae	--NA--	Signaling-peptide	"Plant defense; Protease inhibitor; Secreted; Signal; Thiol protease inhibitor | Cysteine proteinase inhibitor 10 precursor (Oryzacystatin-10),(Oryzacystatin X) (OC-X).Secreted (Potential)."	--NA--	KMATSPMLFLVSLLLVLVAAATGDEASPSNAAAPAAPVLVGGRTEIRDVGSNKAVQSLGRFAVAEHNRRLRHGGSGGPADPVPVKLAFARVVEAQKQVVSGVAYYLKVAASARDPRGGAAAGGDRVFDAVVVVKAWLKSKELVSFTPASST	151	"Experimental evidence at transcript level"	15447.81	15438.32	10.15	--NA--	"FUNCTION:Specific inhibitor of cysteine proteinases. Probably involved in the regulation of endogenous processes and in defense against pests and pathogens (By similarity).SIMILARITY:Belongs to the cystatin family. Phytocystatin subfamily.SIMILARITY:Contains 1 cystatin domain.SEQUENCE CAUTION:Sequence=EAY93675.1; Type=Frameshift; Positions=Several; Sequence=EAY93675.1; Type=Miscellaneous discrepancy; Note=Sequencing errors; "