Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5885 |
| Peptide Name | ITR1_NICSY |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Nicotiana sylvestris |
| Plant Source (Common Name) | Wood tobacco |
| Plant Family | Solanaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Protease inhibitor; Secreted; Serine protease inhibitor; Signal; Vacuole | Trypsin inhibitor 1 precursor (Trypsin inhibitor I) (NSTI-I).Vacuole (Potential). Secreted (Potential). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | KENSKLTNVPSVLNGSPVTKDFRCERVRLFVNVLDFVVQIPRVGMVKLALVVIFLLLASLFQPLTAQSSCPGNKKETWPELIGVPAKFAREIIQ |
| Sequence Length | 94 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 10464.45 |
| Monoisotopic Molecular Weight (Da) | 10457.79 |
| Isoelectric Point (pI) | 9.69 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q02214 |
| NCBI | --NA-- |
| EMBL | M74102 |
| Link to Source Databases | SPdb128544 |
|---|
| Addtional Information | FUNCTION:Stress response. Inhibits trypsin. May play a role in the reentering of protoplasts into the cell cycle.TISSUE SPECIFICITY:Mesophyll protoplasts and to a much lesser extent, roots and germinating seeds.DEVELOPMENTAL STAGE:Before reinitiation of the DNA replicational activity.SIMILARITY:Belongs to the protease inhibitor I13 (potato type I serine protease inhibitor) family. |
