PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5885	ITR1_NICSY	--NA--	"Nicotiana sylvestris"	Solanaceae	--NA--	Signaling-peptide	"Protease inhibitor; Secreted; Serine protease inhibitor; Signal; Vacuole | Trypsin inhibitor 1 precursor (Trypsin inhibitor I) (NSTI-I).Vacuole (Potential). Secreted (Potential)."	--NA--	KENSKLTNVPSVLNGSPVTKDFRCERVRLFVNVLDFVVQIPRVGMVKLALVVIFLLLASLFQPLTAQSSCPGNKKETWPELIGVPAKFAREIIQ	94	"Experimental evidence at transcript level"	10464.45	10457.79	9.69	--NA--	"FUNCTION:Stress response. Inhibits trypsin. May play a role in the reentering of protoplasts into the cell cycle.TISSUE SPECIFICITY:Mesophyll protoplasts and to a much lesser extent, roots and germinating seeds.DEVELOPMENTAL STAGE:Before reinitiation of the DNA replicational activity.SIMILARITY:Belongs to the protease inhibitor I13 (potato type I serine protease inhibitor) family."