Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5884 |
| Peptide Name | MIRA_RICDU |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Synsepalum dulcificum |
| Plant Source (Common Name) | Miracle fruit |
| Plant Family | Sapotaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Direct protein sequencing; Glycoprotein; Signal; Taste-modifying protein | Miraculin precursor (MIR). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | KEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGMKELTMLSLSFFFVSALLAAAANPLLSAADSAPNPVLDIDGEKLRTGTNYNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYFYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENP |
| Sequence Length | 220 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 24366.91 |
| Monoisotopic Molecular Weight (Da) | 24351.23 |
| Isoelectric Point (pI) | 7.7 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P13087 |
| NCBI | --NA-- |
| EMBL | D38598 |
| Link to Source Databases | SPdb153941 |
|---|
| Addtional Information | FUNCTION:Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.SUBUNIT:Homotetramer; dimer of homodimer.TISSUE SPECIFICITY:Expressed in fruit pulp after pollination. Not expressed in seeds, stems or leaves.PTM:Glycosylated; contains as much as 13,9% of sugars (glucosamine, mannose, galactose, xylose, and fucose).SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family.WEB RESOURCE:Name=Protein Spotlight; Note=The sweet side of life - Issue 17 of December 2001; URL="http://www.expasy.org/spotlight/back_issues/sptlt017.shtml"; |
