PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5884	MIRA_RICDU	--NA--	"Synsepalum dulcificum"	Sapotaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Glycoprotein; Signal; Taste-modifying protein | Miraculin precursor (MIR)."	--NA--	KEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGMKELTMLSLSFFFVSALLAAAANPLLSAADSAPNPVLDIDGEKLRTGTNYNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYFYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENP	220	"Experimental evidence at protein level"	24366.91	24351.23	7.7	--NA--	"FUNCTION:Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.SUBUNIT:Homotetramer; dimer of homodimer.TISSUE SPECIFICITY:Expressed in fruit pulp after pollination. Not expressed in seeds, stems or leaves.PTM:Glycosylated; contains as much as 13,9% of sugars (glucosamine, mannose, galactose, xylose, and fucose).SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family.WEB RESOURCE:Name=Protein Spotlight; Note=The sweet side of life - Issue 17 of December 2001; URL=""http://www.expasy.org/spotlight/back_issues/sptlt017.shtml""; "