Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5814 |
| Peptide Name | ALL1_ARTVU |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Artemisia vulgaris |
| Plant Source (Common Name) | Mugwort |
| Plant Family | Asteraceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Allergen; Direct protein sequencing; Glycoprotein; Signal | Major pollen allergen Art v 1 precursor. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSMAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKCPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH |
| Sequence Length | 132 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 13404.26 |
| Monoisotopic Molecular Weight (Da) | 13395.29 |
| Isoelectric Point (pI) | 7.64 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q84ZX5 |
| NCBI | --NA-- |
| EMBL | AF493943 |
| Link to Source Databases | SPdb7835 |
|---|
| Addtional Information | DOMAIN:Contains several extensin-like repeats in the C-terminal section.PTM:Around 76% of the prolines are hydroxylated.PTM:O-glycosylated. O-linkage of 3 galactoses plus 9-16 or 21-23 arabinose residues attached on one or two hydroxyprolines.ALLERGEN:Causes an allergic reaction in human.MISCELLANEOUS:Post-translational modifications might be important in the formation of epitopes recognized by IgE antibodies.SIMILARITY:In the N-terminal section; belongs to the plant defensin family. |
