PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5814	ALL1_ARTVU	--NA--	"Artemisia vulgaris"	Asteraceae	--NA--	Signaling-peptide	"Allergen; Direct protein sequencing; Glycoprotein; Signal | Major pollen allergen Art v 1 precursor."	--NA--	IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSMAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKCPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH	132	"Experimental evidence at protein level"	13404.26	13395.29	7.64	--NA--	"DOMAIN:Contains several extensin-like repeats in the C-terminal section.PTM:Around 76% of the prolines are hydroxylated.PTM:O-glycosylated. O-linkage of 3 galactoses plus 9-16 or 21-23 arabinose residues attached on one or two hydroxyprolines.ALLERGEN:Causes an allergic reaction in human.MISCELLANEOUS:Post-translational modifications might be important in the formation of epitopes recognized by IgE antibodies.SIMILARITY:In the N-terminal section; belongs to the plant defensin family."