Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5798 |
| Peptide Name | C550B_CYACA |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Cyanidium caldarium |
| Plant Source (Common Name) | Algae |
| Plant Family | Galdieriaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Chloroplast; Direct protein sequencing; Electron transport; Heme; Iron; Membrane; Metal-binding; Photosynthesis; Photosystem II; Plastid; Signal; Thylakoid; Transport | Cytochrome c-550 precursor (Cytochrome c550).Plastid, chloroplast thylakoid membrane; Peripheral membrane protein; Lumenal si |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | IAQIHPSIASSDIFPKMRDLSEDDLYAIAAHILTQPQIQAEKWGGGKIYYMFVKMIGWLVLFLFAHQTWAIEVAKDTNGGILNIAPEQLKRGKRLFNSHCSSCHVGGITKTNPNIGLDLESLSLATPPRNNLDALVDYMKNPTTYDGSESTKRSM |
| Sequence Length | 155 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 17220.77 |
| Monoisotopic Molecular Weight (Da) | 17209.77 |
| Isoelectric Point (pI) | 7.13 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q76FB0 |
| NCBI | --NA-- |
| EMBL | AB105371 |
| Link to Source Databases | SPdb27399 |
|---|
| Addtional Information | FUNCTION:Low-potential cytochrome c that plays a role in the oxygen-evolving complex of photosystem II (PSII). Unlike Synechococcus vulcanus it does not bind by itself to PSII, but requires all extrinsic members of the OEC.COFACTOR:Binds 1 heme group covalently per subunit (By similarity).SUBUNIT:The oxygen-evolving complex in red algae is composed of psbO (OEC33), psbQ', cytochrome c-550 and psbU.SIMILARITY:Belongs to the cytochrome c family. PsbV subfamily. |
