PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5798	C550B_CYACA	--NA--	"Cyanidium caldarium"	Galdieriaceae	--NA--	Signaling-peptide	"Chloroplast; Direct protein sequencing; Electron transport; Heme; Iron; Membrane; Metal-binding; Photosynthesis; Photosystem II; Plastid; Signal; Thylakoid; Transport | Cytochrome c-550 precursor (Cytochrome c550).Plastid, chloroplast thylakoid membrane; Peripheral membrane protein; Lumenal si"	--NA--	IAQIHPSIASSDIFPKMRDLSEDDLYAIAAHILTQPQIQAEKWGGGKIYYMFVKMIGWLVLFLFAHQTWAIEVAKDTNGGILNIAPEQLKRGKRLFNSHCSSCHVGGITKTNPNIGLDLESLSLATPPRNNLDALVDYMKNPTTYDGSESTKRSM	155	"Experimental evidence at protein level"	17220.77	17209.77	7.13	--NA--	"FUNCTION:Low-potential cytochrome c that plays a role in the oxygen-evolving complex of photosystem II (PSII). Unlike Synechococcus vulcanus it does not bind by itself to PSII, but requires all extrinsic members of the OEC.COFACTOR:Binds 1 heme group covalently per subunit (By similarity).SUBUNIT:The oxygen-evolving complex in red algae is composed of psbO (OEC33), psbQ', cytochrome c-550 and psbU.SIMILARITY:Belongs to the cytochrome c family. PsbV subfamily."