Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_5751
Peptide Name	CPI1_SOLTU
PMID(s)	--NA--
Plant Source (Scientific Name)	Solanum tuberosum
Plant Source (Common Name)	Potato
Plant Family	Solanaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	Direct protein sequencing; Protease inhibitor; Signal; Thiol protease inhibitor; Vacuole | Cysteine protease inhibitor 1 precursor (PCPI 8.3) (P340) (P34021).Vacuole (By similarity).
Activity Against	--NA--
IC50 value	--NA--
Sequence	GTPVVFVRKSESDYGDVVRVMTVVYIKFFVKTTKLCVDQTVWKVNDEQLVGYPRLVTVDDDKDFIPFVFIKAMKSINILSFLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEVTGGKVGNENDIFKIMKTDLVTPGGSKYVYKLLHCPSHLGCKNIGGNFKN
Sequence Length	222
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	24683.58
Monoisotopic Molecular Weight (Da)	24667.77
Isoelectric Point (pI)	6.47
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_5751

External links (Uniprot, PDB and Source Information Database)
Uniprot	P20347
NCBI	--NA--
EMBL	X13181
Link to Source Databases	SPdb47488
Addtional Information	FUNCTION:Potent inhibitor of cathepsin l (cysteine protease).Does not inhibit trypsin or chymotrypsin (serine proteases). May protect the plant by inhibiting proteases of invading organisms.TISSUE SPECIFICITY:Tubers, leaves.INDUCTION:By wounding. Also expressed in upper non-wounded systemic leaves.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family.SEQUENCE CAUTION:Sequence=AAA33844.1; Type=Frameshift; Positions=59, 88;