PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5751	CPI1_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Protease inhibitor; Signal; Thiol protease inhibitor; Vacuole | Cysteine protease inhibitor 1 precursor (PCPI 8.3) (P340) (P34021).Vacuole (By similarity)."	--NA--	GTPVVFVRKSESDYGDVVRVMTVVYIKFFVKTTKLCVDQTVWKVNDEQLVGYPRLVTVDDDKDFIPFVFIKAMKSINILSFLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEVTGGKVGNENDIFKIMKTDLVTPGGSKYVYKLLHCPSHLGCKNIGGNFKN	222	"Experimental evidence at protein level"	24683.58	24667.77	6.47	--NA--	"FUNCTION:Potent inhibitor of cathepsin l (cysteine protease).Does not inhibit trypsin or chymotrypsin (serine proteases). May protect the plant by inhibiting proteases of invading organisms.TISSUE SPECIFICITY:Tubers, leaves.INDUCTION:By wounding. Also expressed in upper non-wounded systemic leaves.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family.SEQUENCE CAUTION:Sequence=AAA33844.1; Type=Frameshift; Positions=59, 88; "