Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_5523 |
| Peptide Name | LCB1_ROBPS |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Robinia pseudoacacia |
| Plant Source (Common Name) | Black locust |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Calcium; Direct protein sequencing; Glycoprotein; Lectin; Manganese; Metal-binding; Signal | Bark agglutinin I polypeptide A precursor (RPbAI) (LECRPA1). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | FQRDALVTSTGVLQLTNVVNGVPSGKSLGRALYAAPFQIWDSTTGNVASFMTSYNFKTQTSFPLLLSISFFFLLLLNKVNSTGSLSFSFPKFAPNQPYLIQIVAVEFDTFSNIHFDPKGRHMGINVNSIVSIKTVPWNWTNGEVANVFISVTSFSFIIQAPNPTTTADGLAFFLAPVDTQPLDVGGMLGIFKDGYFNKSNYEASTKSLTASLVYPSLETSFIVHAIVDVKDVLPEWVRFGFSATTGIDKGYVQTNDVLSWSFESNLPGGNSVASVKNAGLSTYAA |
| Sequence Length | 285 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 30928.1 |
| Monoisotopic Molecular Weight (Da) | 30908.77 |
| Isoelectric Point (pI) | 5.9 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q41159 |
| NCBI | --NA-- |
| EMBL | U12782 |
| Link to Source Databases | SPdb136808 |
| Addtional Information | FUNCTION:N-acetyl-D-galactosamine specific lectin. Bark lectins are storage protein that probably maintains stocks of nitrogen during dormant period. Self-aggregatable molecules that can bind their own carbohydrate side chains. They could also play a role in the plant's defense against phytophagous invertebrates or herbivorous higher animals.SUBUNIT:RPbAI is composed of two polypeptides, A and B, that associate into five different tetrameric isolectins. The A4 combination is the only one devoid of agglutination activity.Isoform B4 displays maximal agglutination activity.TISSUE SPECIFICITY:Strong expression in seed. Lower levels in the flower, and the bark of the roots. No expression in leaf. The lectin accumulates in the inner bark in autumn.SIMILARITY:Belongs to the leguminous lectin family. |