PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5523	LCB1_ROBPS	--NA--	"Robinia pseudoacacia"	Fabaceae	--NA--	Signaling-peptide	"3D-structure; Calcium; Direct protein sequencing; Glycoprotein; Lectin; Manganese; Metal-binding; Signal | Bark agglutinin I polypeptide A precursor (RPbAI) (LECRPA1)."	--NA--	FQRDALVTSTGVLQLTNVVNGVPSGKSLGRALYAAPFQIWDSTTGNVASFMTSYNFKTQTSFPLLLSISFFFLLLLNKVNSTGSLSFSFPKFAPNQPYLIQIVAVEFDTFSNIHFDPKGRHMGINVNSIVSIKTVPWNWTNGEVANVFISVTSFSFIIQAPNPTTTADGLAFFLAPVDTQPLDVGGMLGIFKDGYFNKSNYEASTKSLTASLVYPSLETSFIVHAIVDVKDVLPEWVRFGFSATTGIDKGYVQTNDVLSWSFESNLPGGNSVASVKNAGLSTYAA	285	"Experimental evidence at protein level"	30928.1	30908.77	5.9	--NA--	"FUNCTION:N-acetyl-D-galactosamine specific lectin. Bark lectins are storage protein that probably maintains stocks of nitrogen during dormant period. Self-aggregatable molecules that can bind their own carbohydrate side chains. They could also play a role in the plant's defense against phytophagous invertebrates or herbivorous higher animals.SUBUNIT:RPbAI is composed of two polypeptides, A and B, that associate into five different tetrameric isolectins. The A4 combination is the only one devoid of agglutination activity.Isoform B4 displays maximal agglutination activity.TISSUE SPECIFICITY:Strong expression in seed. Lower levels in the flower, and the bark of the roots. No expression in leaf. The lectin accumulates in the inner bark in autumn.SIMILARITY:Belongs to the leguminous lectin family."