Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5399 |
| Peptide Name | CYT1_ORYSJ |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Oryza sativa subsp. Japonica |
| Plant Source (Common Name) | Rice |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Alternative splicing; Direct protein sequencing; Plant defense; Protease inhibitor; Secreted; Signal; Thiol protease inhibitor | Cysteine proteinase inhibitor 1 precursor (Oryzacystatin-1),(Oryzacystatin I) (OC-I) (SPOC-I) (OsCP1).Secreted (Potential). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | EPVGNENDLHLVDLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFMRKYRVAGLVAALLVLHSLATPSAQAEAHRAGGEGEEKMSSDGGPVLGGVTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPVDASANA |
| Sequence Length | 140 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 15355.49 |
| Monoisotopic Molecular Weight (Da) | 15345.93 |
| Isoelectric Point (pI) | 5.6 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P09229 |
| NCBI | --NA-- |
| EMBL | M29259 |
| Link to Source Databases | SPdb56075 |
|---|
| Addtional Information | FUNCTION:There are two distinct cystatins in rice seeds (Oryzacystatin-1 and -2) with different specificities against cysteine proteinases. May be involved in the control of germination by inhibition of endogenous cysteine proteinases. May play a role in defense by inhibiting exogenous proteases such as those present in digestive tracks of insects and nematodes.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P09229-1; Sequence=Displayed; Name=2; IsoId=P09229-2; Sequence=VSP_023023, VSP_023024; Note=Derived from EST data. No experimental confirmation available;DEVELOPMENTAL STAGE:Expressed in rice seeds between 2 and 4 weeks after flowering.BIOTECHNOLOGY:Introduction by genetic manipulation and expression in potato or banana confers resistance to insects and nematodes.SIMILARITY:Belongs to the cystatin family. Phytocystatin subfamily.SIMILARITY:Contains 1 cystatin domain.SEQUENCE CAUTION:Sequence=AAB66355.1; Type=Frameshift; Positions=18; |
