PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5399	CYT1_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"3D-structure; Alternative splicing; Direct protein sequencing; Plant defense; Protease inhibitor; Secreted; Signal; Thiol protease inhibitor | Cysteine proteinase inhibitor 1 precursor (Oryzacystatin-1),(Oryzacystatin I) (OC-I) (SPOC-I) (OsCP1).Secreted (Potential)."	--NA--	EPVGNENDLHLVDLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFMRKYRVAGLVAALLVLHSLATPSAQAEAHRAGGEGEEKMSSDGGPVLGGVTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPVDASANA	140	"Experimental evidence at protein level"	15355.49	15345.93	5.6	--NA--	"FUNCTION:There are two distinct cystatins in rice seeds (Oryzacystatin-1 and -2) with different specificities against cysteine proteinases. May be involved in the control of germination by inhibition of endogenous cysteine proteinases. May play a role in defense by inhibiting exogenous proteases such as those present in digestive tracks of insects and nematodes.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P09229-1; Sequence=Displayed; Name=2; IsoId=P09229-2; Sequence=VSP_023023, VSP_023024; Note=Derived from EST data. No experimental confirmation available;DEVELOPMENTAL STAGE:Expressed in rice seeds between 2 and 4 weeks after flowering.BIOTECHNOLOGY:Introduction by genetic manipulation and expression in potato or banana confers resistance to insects and nematodes.SIMILARITY:Belongs to the cystatin family. Phytocystatin subfamily.SIMILARITY:Contains 1 cystatin domain.SEQUENCE CAUTION:Sequence=AAB66355.1; Type=Frameshift; Positions=18; "