Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5360 |
| Peptide Name | THGF_TOBAC |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Nicotiana tabacum |
| Plant Source (Common Name) | Tobacco |
| Plant Family | Solanaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Cell wall; Plant defense; Plant toxin; Secreted; Signal; Toxin; Vacuole | Flower-specific gamma-thionin precursor.Secreted, cell wall (Potential). Vacuole (Potential). Note=Possibly the cell wal |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | EIMDNMARSLCFMAFAILAMMLFVAYEVQARECKTESNTFPGICITKPPCRKACISEKFTDGHCSKLLRRCLCTKPCVFDEKMIKTGAETLVEEAKTLAAALLEE |
| Sequence Length | 105 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 11749.98 |
| Monoisotopic Molecular Weight (Da) | 11741.77 |
| Isoelectric Point (pI) | 6.82 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P32026 |
| NCBI | --NA-- |
| EMBL | Z11748 |
| Link to Source Databases | SPdb292333 |
|---|
| Addtional Information | FUNCTION:Involved in floral organogenesis. May play a protective role in flowers by protecting the reproductive organs from potential pathogen attack.TISSUE SPECIFICITY:Flower. Found in petals, stamen and pistils, but not in sepals. In particular, accumulation in a configuration surrounding the inner reproductive whorls.DEVELOPMENTAL STAGE:Accumulates in developing flowers and its level drops as flowers mature.SIMILARITY:Belongs to the plant defensin family. |
