PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5360	THGF_TOBAC	--NA--	"Nicotiana tabacum"	Solanaceae	--NA--	Signaling-peptide	"3D-structure; Cell wall; Plant defense; Plant toxin; Secreted; Signal; Toxin; Vacuole | Flower-specific gamma-thionin precursor.Secreted, cell wall (Potential). Vacuole (Potential). Note=Possibly the cell wal"	--NA--	EIMDNMARSLCFMAFAILAMMLFVAYEVQARECKTESNTFPGICITKPPCRKACISEKFTDGHCSKLLRRCLCTKPCVFDEKMIKTGAETLVEEAKTLAAALLEE	105	"Experimental evidence at protein level"	11749.98	11741.77	6.82	--NA--	"FUNCTION:Involved in floral organogenesis. May play a protective role in flowers by protecting the reproductive organs from potential pathogen attack.TISSUE SPECIFICITY:Flower. Found in petals, stamen and pistils, but not in sepals. In particular, accumulation in a configuration surrounding the inner reproductive whorls.DEVELOPMENTAL STAGE:Accumulates in developing flowers and its level drops as flowers mature.SIMILARITY:Belongs to the plant defensin family."