Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5289 |
| Peptide Name | KAB1_OLDAF |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Oldenlandia affinis |
| Plant Source (Common Name) | Blue Diamond Flower |
| Plant Family | Rubiaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Antibiotic; Antimicrobial; Cytolysis; Direct protein sequencing; Hemolysis; Knottin; Oxidation; Pharmaceutical; Plant defense; Signal | Kalata-B1 precursor. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | EATLVTDVAEKMFLRKMKAEAKTSETADQVFLKQLQLKGLPVCGETCVGGMAKFTVCLLLCLLLAAFVGAFGSELSDSHKTTLVNEIAEKMLQRKILDGVTCNTPGCTCSWPVCTRNGLPSLAA |
| Sequence Length | 124 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 13270.67 |
| Monoisotopic Molecular Weight (Da) | 13261.77 |
| Isoelectric Point (pI) | 7.76 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P56254 |
| NCBI | --NA-- |
| EMBL | AF393825 |
| Link to Source Databases | SPdb129826 |
|---|
| Addtional Information | FUNCTION:Probably participates in a plant defense mechanism. Has antibiotic activity. Has a diuretic effect. Has a uterotonic effect in humans. Active against the Gram-positive Staphylococcus aureus with a minimum inhibition concentration of approximately 0.2 microM. Relatively ineffective against Gram-negative bacteria such as Escherichia coli and Pseudomonas aeruginosa. Inhibitory effect on the growth and development of larvae from Helicoverpa punctigera. The unmodified form has hemolytic activity, the oxidized form lacks hemolytic activity. If the protein is linearized, hemolytic activity is lost.TISSUE SPECIFICITY:Leaves and stems. Lower in roots.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.PTM:Kalata-B1 is a cyclic peptide which occurs in three forms: with unmodified Trp-111, with Trp-111 oxidized to form oxindolylalanine and with Trp-111 oxidized to form N- formylkynurenine. Oxidation is enhanced by exposure to sunlight.MASS SPECTROMETRY:Mass=2892; Method=Electrospray; Range=89-117; Source=PubMed:7703226;MASS SPECTROMETRY:Mass=2982.4; Method=Electrospray; Range=89-117; Source=PubMed:17534989;MASS SPECTROMETRY:Mass=2908.4; Method=Electrospray; Range=89-117; Note=With oxindolylalanine; Source=PubMed:17534989;MASS SPECTROMETRY:Mass=2924.4; Method=Electrospray; Range=89-117; Note=With N-formylkynurenine; Source=PubMed:17534989;PHARMACEUTICAL:The uteroactive properties of Kalata have been discovered by African traditional medicine. It is used as an ingredient of an herbal tea to accelerate child birth.SIMILARITY:Belongs to the cyclotide family. Moebius subfamily.WEB RESOURCE:Name=Protein Spotlight; Note=The protein with a topological twist - Issue 20 of March 2002; URL="http://www.expasy.org/spotlight/back_issues/sptlt020.shtml"; |
