PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5289	KAB1_OLDAF	--NA--	"Oldenlandia affinis"	Rubiaceae	--NA--	Signaling-peptide	"3D-structure; Antibiotic; Antimicrobial; Cytolysis; Direct protein sequencing; Hemolysis; Knottin; Oxidation; Pharmaceutical; Plant defense; Signal | Kalata-B1 precursor."	--NA--	EATLVTDVAEKMFLRKMKAEAKTSETADQVFLKQLQLKGLPVCGETCVGGMAKFTVCLLLCLLLAAFVGAFGSELSDSHKTTLVNEIAEKMLQRKILDGVTCNTPGCTCSWPVCTRNGLPSLAA	124	"Experimental evidence at protein level"	13270.67	13261.77	7.76	--NA--	"FUNCTION:Probably participates in a plant defense mechanism. Has antibiotic activity. Has a diuretic effect. Has a uterotonic effect in humans. Active against the Gram-positive Staphylococcus aureus with a minimum inhibition concentration of approximately 0.2 microM. Relatively ineffective against Gram-negative bacteria such as Escherichia coli and Pseudomonas aeruginosa. Inhibitory effect on the growth and development of larvae from Helicoverpa punctigera. The unmodified form has hemolytic activity, the oxidized form lacks hemolytic activity. If the protein is linearized, hemolytic activity is lost.TISSUE SPECIFICITY:Leaves and stems. Lower in roots.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.PTM:Kalata-B1 is a cyclic peptide which occurs in three forms: with unmodified Trp-111, with Trp-111 oxidized to form oxindolylalanine and with Trp-111 oxidized to form N- formylkynurenine. Oxidation is enhanced by exposure to sunlight.MASS SPECTROMETRY:Mass=2892; Method=Electrospray; Range=89-117; Source=PubMed:7703226;MASS SPECTROMETRY:Mass=2982.4; Method=Electrospray; Range=89-117; Source=PubMed:17534989;MASS SPECTROMETRY:Mass=2908.4; Method=Electrospray; Range=89-117; Note=With oxindolylalanine; Source=PubMed:17534989;MASS SPECTROMETRY:Mass=2924.4; Method=Electrospray; Range=89-117; Note=With N-formylkynurenine; Source=PubMed:17534989;PHARMACEUTICAL:The uteroactive properties of Kalata have been discovered by African traditional medicine. It is used as an ingredient of an herbal tea to accelerate child birth.SIMILARITY:Belongs to the cyclotide family. Moebius subfamily.WEB RESOURCE:Name=Protein Spotlight; Note=The protein with a topological twist - Issue 20 of March 2002; URL=""http://www.expasy.org/spotlight/back_issues/sptlt020.shtml""; "