Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5192 |
| Peptide Name | LECR_PEA |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Pisum sativum |
| Plant Source (Common Name) | Garden pea |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Direct protein sequencing; Glycoprotein; Lectin; Membrane; Signal | Nodule lectin precursor (PsNlec-1).Symbiosome, peribacteroid space. Symbiosome, peribacteroid membrane. Note=Also a |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | DSPSSTLSAAIIYENGKISTISQVIDLKTVLPNTVQIGLSAATLTGESYSFVTSFSFVIDTTEGPITDGLIFFIAPPGTVIPQNSTTPFLGVVDSETSINIHSWSFVSDLETTASYVSNIMAFYRTNLPTRELFSLVSVVIVLLATNINSVQALSFNFTKLTTANSGVTFQGDAQILPSGLIALTKSSPFPPGQYFTTVGRALSSNLVPLWDSATGKAASRFVGLEFDLYRNSWDPEGRHIGIDINSIISTKTVTYNLVSGSLTKVIIIY |
| Sequence Length | 270 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 28957.87 |
| Monoisotopic Molecular Weight (Da) | 28940.05 |
| Isoelectric Point (pI) | 4.81 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q40987 |
| NCBI | --NA-- |
| EMBL | U31981 |
| Link to Source Databases | SPdb137583 |
|---|
| Addtional Information | FUNCTION:Involved in symbiosome development.TISSUE SPECIFICITY:Expressed in nodules of Rhizobium-infected and uninfected roots and in the root stele near the nodule attachment point. In roots which have been colonized by the endomycorrhizal fungus G.versiforme, detected only in cortical cells colonized by the fungus, mainly those containing arbuscules.DEVELOPMENTAL STAGE:Expression increases gradually as nodules develop and then remains constant from 4 weeks to 2 months.Expressed at lower levels in senescing and non-fixing nodules.INDUCTION:By infection with the endomycorrhizal fungus G.versiforme.PTM:Glycosylated in a boron-dependent manner. Glycosylation is required for localization to symbiosomes. 3 different glycosylation variants, NLEC-1A, NLEC-1B and NLEC-1C, have been identified.SIMILARITY:Belongs to the leguminous lectin family. |
