PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5192	LECR_PEA	--NA--	"Pisum sativum"	Fabaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Glycoprotein; Lectin; Membrane; Signal | Nodule lectin precursor (PsNlec-1).Symbiosome, peribacteroid space. Symbiosome, peribacteroid membrane. Note=Also a"	--NA--	DSPSSTLSAAIIYENGKISTISQVIDLKTVLPNTVQIGLSAATLTGESYSFVTSFSFVIDTTEGPITDGLIFFIAPPGTVIPQNSTTPFLGVVDSETSINIHSWSFVSDLETTASYVSNIMAFYRTNLPTRELFSLVSVVIVLLATNINSVQALSFNFTKLTTANSGVTFQGDAQILPSGLIALTKSSPFPPGQYFTTVGRALSSNLVPLWDSATGKAASRFVGLEFDLYRNSWDPEGRHIGIDINSIISTKTVTYNLVSGSLTKVIIIY	270	"Experimental evidence at protein level"	28957.87	28940.05	4.81	--NA--	"FUNCTION:Involved in symbiosome development.TISSUE SPECIFICITY:Expressed in nodules of Rhizobium-infected and uninfected roots and in the root stele near the nodule attachment point. In roots which have been colonized by the endomycorrhizal fungus G.versiforme, detected only in cortical cells colonized by the fungus, mainly those containing arbuscules.DEVELOPMENTAL STAGE:Expression increases gradually as nodules develop and then remains constant from 4 weeks to 2 months.Expressed at lower levels in senescing and non-fixing nodules.INDUCTION:By infection with the endomycorrhizal fungus G.versiforme.PTM:Glycosylated in a boron-dependent manner. Glycosylation is required for localization to symbiosomes. 3 different glycosylation variants, NLEC-1A, NLEC-1B and NLEC-1C, have been identified.SIMILARITY:Belongs to the leguminous lectin family."