Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_5090 |
| Peptide Name | SSRA_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Calcium; Complete proteome; Endoplasmic reticulum; Glycoprotein; Membrane; Phosphoprotein; Signal; Transmembrane | Translocon-associated protein subunit alpha precursor (TRAP-alpha),(Signal sequence receptor subunit alpha) (SSR-alpha).Endoplasmic reticulum membrane; Single-pass type I membrane protein. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | DHDLDMNLSSFPGVETVCVFPKNSAKLVPAGEETELLVGLKNEGKTRVGVGAFDLVGYIIYDVEGKPYQSVFYNGTIEVVESGGLLSGESVFLLTLGIGLGKTKNKKNLLLLGLWAYSQVQRLTKKTKKVSKVEVGTRSTEASLDEWLEGTTLAKTSSMGIRASVHLPYDHKLLVQNLTMLRLNNASIPTSLQATFPYIFAVSQYLQPMMNLRVLFLALLLLASPLLQVARCQSDAEDHSSLVDDVVGENTDDAVEED |
| Sequence Length | 258 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 28167.33 |
| Monoisotopic Molecular Weight (Da) | 28149.68 |
| Isoelectric Point (pI) | 5.08 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P45434 |
| NCBI | --NA-- |
| EMBL | AC006264 |
| Link to Source Databases | SPdb276495 |
| Addtional Information | FUNCTION:TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. May be involved in the recycling of the translocation apparatus after completion of the translocation process or may function as a membrane-bound chaperone facilitating folding of translocated proteins.SUBUNIT:Heterotetramer of TRAP-alpha, TRAP-beta, TRAP-delta and TRAP-gamma.DOMAIN:Shows a remarkable charge distribution with the N-terminus being highly negatively charged, and the cytoplasmic C-terminus positively charged.PTM:Phosphorylated in its cytoplasmic tail (By similarity).MISCELLANEOUS:Seems to bind calcium.SIMILARITY:Belongs to the TRAP-alpha family. |