PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5090	SSRA_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Calcium; Complete proteome; Endoplasmic reticulum; Glycoprotein; Membrane; Phosphoprotein; Signal; Transmembrane | Translocon-associated protein subunit alpha precursor (TRAP-alpha),(Signal sequence receptor subunit alpha) (SSR-alpha).Endoplasmic reticulum membrane; Single-pass type I membrane protein."	--NA--	DHDLDMNLSSFPGVETVCVFPKNSAKLVPAGEETELLVGLKNEGKTRVGVGAFDLVGYIIYDVEGKPYQSVFYNGTIEVVESGGLLSGESVFLLTLGIGLGKTKNKKNLLLLGLWAYSQVQRLTKKTKKVSKVEVGTRSTEASLDEWLEGTTLAKTSSMGIRASVHLPYDHKLLVQNLTMLRLNNASIPTSLQATFPYIFAVSQYLQPMMNLRVLFLALLLLASPLLQVARCQSDAEDHSSLVDDVVGENTDDAVEED	258	"Experimental evidence at transcript level"	28167.33	28149.68	5.08	--NA--	"FUNCTION:TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. May be involved in the recycling of the translocation apparatus after completion of the translocation process or may function as a membrane-bound chaperone facilitating folding of translocated proteins.SUBUNIT:Heterotetramer of TRAP-alpha, TRAP-beta, TRAP-delta and TRAP-gamma.DOMAIN:Shows a remarkable charge distribution with the N-terminus being highly negatively charged, and the cytoplasmic C-terminus positively charged.PTM:Phosphorylated in its cytoplasmic tail (By similarity).MISCELLANEOUS:Seems to bind calcium.SIMILARITY:Belongs to the TRAP-alpha family."