Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5063 |
| Peptide Name | CP19D_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Chaperone; Complete proteome; Cyclosporin; Cytoplasm; Endoplasmic reticulum; Isomerase; Membrane; Rotamase; Signal | Peptidyl-prolyl cis-trans isomerase CYP19-4 precursor (EC 5.2.1.8),(PPIase CYP19-4) (Rotamase CYP19-4) (Cyclophilin of 19 kDa 4),(Cyclophilin-5).Cytoplasm. Membrane. Endoplasmic reticulum. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | DFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDTNGSQFFITGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMIQGGLMAKASFILLGTLFLFGAIASIQAKEDLKEVTHKVYFDVEIDGKSAGRVVITVTTSWLDGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELP |
| Sequence Length | 201 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 21533.73 |
| Monoisotopic Molecular Weight (Da) | 21520.13 |
| Isoelectric Point (pI) | 9.06 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q8LDP4 |
| NCBI | --NA-- |
| EMBL | AF020433 |
| Link to Source Databases | SPdb46957 |
|---|
| Addtional Information | FUNCTION:PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved during embryogenesis and organ development by regulating the folding of EMB30/GNOM, and thus, by modulating its activity.CATALYTIC ACTIVITY:Peptidylproline (omega=180) = peptidylproline (omega=0).ENZYME REGULATION:Binds cyclosporin A (CsA). CsA mediates some of its effects via an inhibitory action on PPIase.SUBUNIT:Interacts with EMB30/GNOM.Note=Mostly cytoplasmic, also membrane-associated. Present in endoplasmic reticulum and barely secreted.TISSUE SPECIFICITY:Ubiquitous, mostly in aerial organs (at protein level).DEVELOPMENTAL STAGE:Mostly expressed in both apical and basal regions in peduncles and stems (including upper roots) before the bolting stage. Later restricted in the apical region. During embryogenesis, accumulates in all cells during globular stage.From the heart stage, more expressed in inner cells than in epidermal cells (at protein level).INDUCTION:Slightly induced by cold and salt stresses.SIMILARITY:Belongs to the cyclophilin-type PPIase family.SIMILARITY:Contains 1 PPIase cyclophilin-type domain. |
