PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5063	CP19D_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Chaperone; Complete proteome; Cyclosporin; Cytoplasm; Endoplasmic reticulum; Isomerase; Membrane; Rotamase; Signal | Peptidyl-prolyl cis-trans isomerase CYP19-4 precursor (EC 5.2.1.8),(PPIase CYP19-4) (Rotamase CYP19-4) (Cyclophilin of 19 kDa 4),(Cyclophilin-5).Cytoplasm. Membrane. Endoplasmic reticulum."	--NA--	DFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDTNGSQFFITGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMIQGGLMAKASFILLGTLFLFGAIASIQAKEDLKEVTHKVYFDVEIDGKSAGRVVITVTTSWLDGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELP	201	"Experimental evidence at protein level"	21533.73	21520.13	9.06	--NA--	"FUNCTION:PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved during embryogenesis and organ development by regulating the folding of EMB30/GNOM, and thus, by modulating its activity.CATALYTIC ACTIVITY:Peptidylproline (omega=180) = peptidylproline (omega=0).ENZYME REGULATION:Binds cyclosporin A (CsA). CsA mediates some of its effects via an inhibitory action on PPIase.SUBUNIT:Interacts with EMB30/GNOM.Note=Mostly cytoplasmic, also membrane-associated. Present in endoplasmic reticulum and barely secreted.TISSUE SPECIFICITY:Ubiquitous, mostly in aerial organs (at protein level).DEVELOPMENTAL STAGE:Mostly expressed in both apical and basal regions in peduncles and stems (including upper roots) before the bolting stage. Later restricted in the apical region. During embryogenesis, accumulates in all cells during globular stage.From the heart stage, more expressed in inner cells than in epidermal cells (at protein level).INDUCTION:Slightly induced by cold and salt stresses.SIMILARITY:Belongs to the cyclophilin-type PPIase family.SIMILARITY:Contains 1 PPIase cyclophilin-type domain."