Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4959 |
| Peptide Name | TRIC_VIOAR |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Viola arvensis |
| Plant Source (Common Name) | European field pansy, Field violet |
| Plant Family | Violaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Cytolysis; Direct protein sequencing; Hemolysis; Knottin; Plant defense; Repeat; Signal | Pro-tricyclons precursor [Contains: Tricyclon-A; Tricyclon-B]. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | CYGTNSLPESNNEKAMVASLEKDVITRAAYENLVNSGAIQGITMTKTIISKTIISNPILEEALVAHFNRKLGGGTIFDCGESCFLGTCYTKGCSCGEWKLMKTMASFVLVLVAAFALPAAFASLETKDVITRAAYEKLVESGAIQGITMTNPILEEALVSHFNRKLGGGTIFDCGESCFLGTCYTKGCSCGEWKLCYGENSLAI |
| Sequence Length | 204 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 21820.22 |
| Monoisotopic Molecular Weight (Da) | 21805.75 |
| Isoelectric Point (pI) | 5.49 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P0C589 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | SPdb299221 |
|---|
| Addtional Information | FUNCTION:Probably participates in a plant defense mechanism. Has a weak hemolytic activity.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines those proteins as knottins.PTM:Proteolytically processed in two steps to yield first two linear precursors, and then two cyclic peptides after removal of the N-terminal repeats (NTR) and short tails.MISCELLANEOUS:Tricyclon-A and tricyclon-B are hybrids of the Bracelet and Moebius subfamilies.SIMILARITY:Belongs to the cyclotide family. |
