PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4959	TRIC_VIOAR	--NA--	"Viola arvensis"	Violaceae	--NA--	Signaling-peptide	"3D-structure; Cytolysis; Direct protein sequencing; Hemolysis; Knottin; Plant defense; Repeat; Signal | Pro-tricyclons precursor [Contains: Tricyclon-A; Tricyclon-B]."	--NA--	CYGTNSLPESNNEKAMVASLEKDVITRAAYENLVNSGAIQGITMTKTIISKTIISNPILEEALVAHFNRKLGGGTIFDCGESCFLGTCYTKGCSCGEWKLMKTMASFVLVLVAAFALPAAFASLETKDVITRAAYEKLVESGAIQGITMTNPILEEALVSHFNRKLGGGTIFDCGESCFLGTCYTKGCSCGEWKLCYGENSLAI	204	"Experimental evidence at protein level"	21820.22	21805.75	5.49	--NA--	"FUNCTION:Probably participates in a plant defense mechanism. Has a weak hemolytic activity.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines those proteins as knottins.PTM:Proteolytically processed in two steps to yield first two linear precursors, and then two cyclic peptides after removal of the N-terminal repeats (NTR) and short tails.MISCELLANEOUS:Tricyclon-A and tricyclon-B are hybrids of the Bracelet and Moebius subfamilies.SIMILARITY:Belongs to the cyclotide family."