Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4890 |
| Peptide Name | EXPA4_ORYSI |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Oryza sativa subsp. Indica |
| Plant Source (Common Name) | Rice |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Cell wall; Membrane; Secreted; Signal | Expansin-A4 precursor (OsEXPA4) (Alpha-expansin-4) (OsEXP4),(OsaEXPa1.22).Secreted, cell wall; Peripheral membrane protein (By similarity). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | CPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQMAIAGVLFLLFLARQASAAGYGGWQSAHATFYGGGDASGTMGGACGYGNLNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQFYSQGYGTNTAALSTALFNDGAACGSCYELRCDNAGSSCLPGSITVTATNF |
| Sequence Length | 246 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 25883.81 |
| Monoisotopic Molecular Weight (Da) | 25867.26 |
| Isoelectric Point (pI) | 8.17 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | A2Y5R6, Q0DHB7 |
| NCBI | --NA-- |
| EMBL | U85246, AF394545 |
| Link to Source Databases | Spdb78141, Spdb78142 |
|---|
| Addtional Information | FUNCTION:Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. Required for normal plant growth. May be required for rapid internodal elongation in deepwater rice during submergence.TISSUE SPECIFICITY:Expressed in lateral root primordia, adventitious root primordia, coleoptiles, shoot apex, leaf primordia, very young leaves, panicles and flowers.DEVELOPMENTAL STAGE:Expressed in the apical region (growing zone) of the root hair. Expressed in the basal growing zone of air-grown internode.INDUCTION:By gibberellin (GA3), submergence and wounding.MISCELLANEOUS:Plants lacking EXPA4 are smaller.SIMILARITY:Belongs to the expansin family. Expansin A subfamily.SIMILARITY:Contains 1 expansin-like CBD domain.SIMILARITY:Contains 1 expansin-like EG45 domain. |
